PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00123.1_g00067.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23439.3 Da    PI: 9.154
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00123.1_g00067.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.74.3e-25958150
                             S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                   SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                             krien  nr vtfskRrng+ KKA+E+ vLCda+va+i+f+s+gk+ +y+
  Rsa1.0_00123.1_g00067.1  9 KRIENVNNRVVTFSKRRNGLVKKAKEITVLCDAKVALIVFASNGKMTDYC 58
                             79*********************************************997 PP

2K-box57.94.5e-2071164199
                    K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkeke 86 
                              yqk sgk+l++ak+e+l++e++ +kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+ +e++l      K+e+l+++ ++ +++ +e
  Rsa1.0_00123.1_g00067.1  71 YQKLSGKKLWDAKHENLNNEIDMIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHGVEHGLD-----KMEFLMTKRRNEKMMVEE 151
                              899***********************************************************6.....89**************** PP

                    K-box  87 lqeenkaLrkkle 99 
                              +++   +L+++ +
  Rsa1.0_00123.1_g00067.1 152 NRQLSFQLQQQEM 164
                              *********9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.151161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-33296IPR002100Transcription factor, MADS-box
CDDcd002651.11E-37280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-263859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-1082159IPR002487Transcription factor, K-box
PROSITE profilePS5129710.35984165IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRGKIEIKR IENVNNRVVT FSKRRNGLVK KAKEITVLCD AKVALIVFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLNNE IDMIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHGVEH GLDKMEFLMT KRRNEKMMVE ENRQLSFQLQ QQEMAIASNA RGMMMKDHDA  180
QFGYRVQPIQ PNLQEKIMSL VID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D3e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_P3e-15163163Myocyte-specific enhancer factor 2B
1tqe_Q3e-15163163Myocyte-specific enhancer factor 2B
1tqe_R3e-15163163Myocyte-specific enhancer factor 2B
1tqe_S3e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00080ChIP-seqTransfer from AT5G20240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9679630.0KC967963.1 Brassica oleracea var. viridis PI.c (PI.c) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013736392.11e-143PREDICTED: floral homeotic protein PISTILLATA-like isoform X1
RefseqXP_013736393.11e-143PREDICTED: floral homeotic protein PISTILLATA-like isoform X2
SwissprotP480071e-139PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLA0A078DHV71e-143A0A078DHV7_BRANA; BnaA03g08030D protein
TrEMBLS5ZGM01e-143S5ZGM0_BRAOV; PI.c
STRINGBra020093.1-P1e-142(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-140MIKC_MADS family protein